PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn054031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family NAC
Protein Properties Length: 404aa    MW: 45248.7 Da    PI: 5.3744
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn054031genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.2e-52231501128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 l+pGfrFhPtdeelv++yLk+k+ gk++++ e+++e+d+yk+ePw+L   +++k+++ ewyfFs+ d+ky +g+r nrat +gyWkatgkd++v + kg
  Achn054031  23 LAPGFRFHPTDEELVQYYLKRKACGKPFRF-EAVSEIDVYKSEPWELSghSRLKTRDLEWYFFSPVDRKYGNGSRLNRATGKGYWKATGKDRQVRH-KG 119
                 579*************************99.89**************85348888888**************************************.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +++g+kktLvf++grap+g++t+Wvmheyrl
  Achn054031 120 QTIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 150
                 9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6117167IPR003441NAC domain
PROSITE profilePS5100558.2723167IPR003441NAC domain
PfamPF023651.6E-2825150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MAHNLGEITP PPQPPVAAAA TSLAPGFRFH PTDEELVQYY LKRKACGKPF RFEAVSEIDV  60
YKSEPWELSG HSRLKTRDLE WYFFSPVDRK YGNGSRLNRA TGKGYWKATG KDRQVRHKGQ  120
TIGMKKTLVF HSGRAPDGKR TNWVMHEYRL VDGAAQDAFV LCRIFQKSGL GPPNGDRYAP  180
FIEEEWDNDA SLVVPGEEAG DEMVNGDDAQ VEGNELEQDI HSTNKSPPRL AELPNLSQTV  240
PFVCKRERSE DCPLPGIANP ETLSLVPNKR TKNDDPNSSN ANGSEDSNTT PPDLCISTTT  300
TTTRTTNFSS TLLEFPLLEP VEPKENIPNN LHAFDASNLE KSVPPGYLKF ISNLENEILN  360
VSMERETLKI ELMRAQAMIN ILQSRIDLVN RDNEELRRVV RDV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D6e-522216719168NAC domain-containing protein 19
3swp_C6e-522216719168NAC domain-containing protein 19
3swp_B6e-522216719168NAC domain-containing protein 19
3swp_A6e-522216719168NAC domain-containing protein 19
3swm_D6e-522216719168NAC domain-containing protein 19
3swm_C6e-522216719168NAC domain-containing protein 19
3swm_B6e-522216719168NAC domain-containing protein 19
3swm_A6e-522216719168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619467.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLA0A068TWS90.0A0A068TWS9_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.29e-97NAC domain containing protein 50